PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla022437
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family BBR-BPC
Protein Properties Length: 339aa    MW: 37723.8 Da    PI: 9.9411
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla022437genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind394.31.7e-12013391301
  GAGA_bind   1 mdddgsre..rnkg.yyepa...aslkenl..glqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla 92 
                md++g+re  r+k+ +y++a   + + +++   +q+m+++aerda+++ernlalsekkaa+aerdma+lqrd+a+aern+al+erdn++++l+++ensl+
  Cla022437   1 MDESGHREngRHKAdQYKSAqggPWMMQHQpsMKQIMTIMAERDAALQERNLALSEKKAALAERDMAYLQRDAAIAERNNALLERDNAIATLQYRENSLT 100
                99****9999****9***5545544444431145***************************************************************998 PP

  GAGA_bind  93 ..salpvgvqvlsgtksidslqqlse...pqledsavelreeekle.al...pieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesa 183
                  +++p+g+q+ +g+k+i++ qq+++   p++++s ++ re++ ++ a    p+ ++ ++a+++k++k++++ ++p +k +k ++k +++ ++ +     
  Cla022437 101 nnMSCPPGCQIARGVKHIHHPQQQQHphvPHMNESNYNSREMHPSNdACpvsPVASESTKARQSKRPKEGKTVTTPNKKVSKGPRKVKREAEDLN----- 195
                7789*******************88888999*******999997642441115555556666666677777777777666664444332222222..... PP

  GAGA_bind 184 der............................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRi 255
                  +                            sk+++k +dl+ln+v++Dest+P+P+CsCtG+ rqCYkWGnGGWqSaCCtttiS+yPLP+++++r+aR+
  Cla022437 196 --KvmlgksqewkdgigimsggddlnkqlvvSKSDWKGQDLGLNQVAFDESTMPAPICSCTGVIRQCYKWGNGGWQSACCTTTISMYPLPAVPNKRHARL 293
                ..111222234789************************************************************************************** PP

  GAGA_bind 256 agrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                +grKmS++af+klL++LaaeG+dls pvDLk+hWAkHGtn+++ti+
  Cla022437 294 GGRKMSGSAFNKLLSRLAAEGHDLSAPVDLKNHWAKHGTNRYITIK 339
                *********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.4E-1721339IPR010409GAGA-binding transcriptional activator
PfamPF062173.6E-1031339IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDESGHRENG RHKADQYKSA QGGPWMMQHQ PSMKQIMTIM AERDAALQER NLALSEKKAA  60
LAERDMAYLQ RDAAIAERNN ALLERDNAIA TLQYRENSLT NNMSCPPGCQ IARGVKHIHH  120
PQQQQHPHVP HMNESNYNSR EMHPSNDACP VSPVASESTK ARQSKRPKEG KTVTTPNKKV  180
SKGPRKVKRE AEDLNKVMLG KSQEWKDGIG IMSGGDDLNK QLVVSKSDWK GQDLGLNQVA  240
FDESTMPAPI CSCTGVIRQC YKWGNGGWQS ACCTTTISMY PLPAVPNKRH ARLGGRKMSG  300
SAFNKLLSRL AAEGHDLSAP VDLKNHWAKH GTNRYITIK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008444782.10.0PREDICTED: protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-152BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A0A0LLL30.0A0A0A0LLL3_CUCSA; Uncharacterized protein
STRINGGLYMA04G02860.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69053449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-143basic pentacysteine 6